Lineage for d1w2ua_ (1w2u A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460534Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 460535Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 460539Species Humicola grisea [TaxId:5527] [101655] (5 PDB entries)
  8. 460543Domain d1w2ua_: 1w2u A: [109129]

Details for d1w2ua_

PDB Entry: 1w2u (more details), 1.52 Å

PDB Description: x-ray crystal structure of the catalytic domain of humicola grisea cel12a in complex with a soaked thio cellotetraose

SCOP Domain Sequences for d1w2ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2ua_ b.29.1.11 (A:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Humicola grisea}
eirslcelygywsgngyellnnlwgkdtatsgwqctyldgtnnggiqwstawewqgapdn
vksypyvgkqiqrgrkisdinsmrtsvswtydrtdiranvaydvftardpdhpnwggdye
lmiwlaryggiypigtfhsqvnlagrtwdlwtgyngnmrvysflppsgdirdfscdikdf
fnylernhgypareqnlivyqvgtecftggparftcrdfradlw

SCOP Domain Coordinates for d1w2ua_:

Click to download the PDB-style file with coordinates for d1w2ua_.
(The format of our PDB-style files is described here.)

Timeline for d1w2ua_: