SCOP 1.73: Domain d1w2ib_: 1w2i B:

Lineage for d1w2ib_ (1w2i B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (2 families)

5. Family d.58.10.1: Acylphosphatase-like [54976] (3 proteins)

6. Protein Acylphosphatase [54977] (4 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [110973] (2 PDB entries)

8. Domain d1w2ib_: 1w2i B: [109128]
   complexed with fmt

Details for d1w2ib_

PDB Entry: 1w2i, 1.5 Å

PDB Description: crystal structuore of acylphosphatase from pyrococcus horikoshii complexed with formate

PDB Compounds: (B:) acylphosphatase

SCOP Domain Sequences for d1w2ib_:

Sequence; same for both SEQRES and ATOM records:

>d1w2ib_ d.58.10.1 (B:) Acylphosphatase {Pyrococcus horikoshii [TaxId: 53953]}
aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
ahqgpplarvtrvevkweqpkgekgfrivg

Timeline for d1w2ib_:

• d1w2ib_ first appeared in SCOP 1.69
  
• d1w2ib_ appears in SCOP 1.71
  
• d1w2ib_ appears in SCOP 1.75
  
• d1w2ib_ appears in the current release, SCOPe 2.08