![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.10: Acylphosphatase-like [54975] (1 family) ![]() |
![]() | Family d.58.10.1: Acylphosphatase-like [54976] (3 proteins) |
![]() | Protein Acylphosphatase [54977] (4 species) |
![]() | Species Pyrococcus horikoshii [TaxId:70601] [110973] (2 PDB entries) |
![]() | Domain d1w2ib_: 1w2i B: [109128] complexed with fmt |
PDB Entry: 1w2i (more details), 1.5 Å
SCOP Domain Sequences for d1w2ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2ib_ d.58.10.1 (B:) Acylphosphatase {Pyrococcus horikoshii} aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw ahqgpplarvtrvevkweqpkgekgfrivg
Timeline for d1w2ib_: