Lineage for d1w2ib_ (1w2i B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504867Superfamily d.58.10: Acylphosphatase-like [54975] (1 family) (S)
  5. 504868Family d.58.10.1: Acylphosphatase-like [54976] (3 proteins)
  6. 504869Protein Acylphosphatase [54977] (3 species)
  7. 504874Species Pyrococcus horikoshii [TaxId:70601] [110973] (1 PDB entry)
  8. 504876Domain d1w2ib_: 1w2i B: [109128]

Details for d1w2ib_

PDB Entry: 1w2i (more details), 1.5 Å

PDB Description: crystal structuore of acylphosphatase from pyrococcus horikoshii complexed with formate

SCOP Domain Sequences for d1w2ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2ib_ d.58.10.1 (B:) Acylphosphatase {Pyrococcus horikoshii}
aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
ahqgpplarvtrvevkweqpkgekgfrivg

SCOP Domain Coordinates for d1w2ib_:

Click to download the PDB-style file with coordinates for d1w2ib_.
(The format of our PDB-style files is described here.)

Timeline for d1w2ib_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w2ia_