Lineage for d1w2ib_ (1w2i B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
    automatically mapped to Pfam PF00708
  6. Protein Acylphosphatase [54977] (4 species)
  7. Species Pyrococcus horikoshii [TaxId:53953] [110973] (2 PDB entries)
    Uniprot P84142
  8. Domain d1w2ib_: 1w2i B: [109128]
    complexed with fmt

Details for d1w2ib_

PDB Entry: 1w2i (more details), 1.5 Å

PDB Description: crystal structuore of acylphosphatase from pyrococcus horikoshii complexed with formate
PDB Compounds: (B:) acylphosphatase

SCOPe Domain Sequences for d1w2ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2ib_ d.58.10.1 (B:) Acylphosphatase {Pyrococcus horikoshii [TaxId: 53953]}
aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
ahqgpplarvtrvevkweqpkgekgfrivg

SCOPe Domain Coordinates for d1w2ib_ are not available.

Timeline for d1w2ib_:

Domains from other chains:
(mouse over for more information)
d1w2ia_