![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) ![]() |
![]() | Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins) automatically mapped to Pfam PF00708 |
![]() | Protein Acylphosphatase [54977] (4 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [110973] (2 PDB entries) Uniprot P84142 |
![]() | Domain d1w2ia_: 1w2i A: [109127] complexed with fmt |
PDB Entry: 1w2i (more details), 1.5 Å
SCOPe Domain Sequences for d1w2ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2ia_ d.58.10.1 (A:) Acylphosphatase {Pyrococcus horikoshii [TaxId: 53953]} aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw ahqgpplarvtrvevkweqpkgekgfrivg
Timeline for d1w2ia_: