Lineage for d1w2ia_ (1w2i A:)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.10: Acylphosphatase-like [54975] (1 family) 
Family d.58.10.1: Acylphosphatase-like [54976] (3 proteins) 
Protein Acylphosphatase [54977] (3 species) Species Pyrococcus horikoshii [TaxId:70601] [110973] (1 PDB entry) 
Domain d1w2ia_: 1w2i A: [109127]
Details for d1w2ia_
PDB Entry: 1w2i (more details), 1.5 Å
PDB Description: crystal structuore of acylphosphatase from pyrococcus horikoshii complexed with formate
SCOP Domain Sequences for d1w2ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2ia_ d.58.10.1 (A:) Acylphosphatase {Pyrococcus horikoshii}
aivrahlkiygrvqgvgfrwsmqrearklgvngwvrnlpdgsveavlegdeervealigw
ahqgpplarvtrvevkweqpkgekgfrivg
SCOP Domain Coordinates for d1w2ia_:
Click to download the PDB-style file with coordinates for d1w2ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w2ia_:
- d1w2ia_ is new in SCOP 1.69
- d1w2ia_ appears in SCOP 1.71
- d1w2ia_ appears in the current release, SCOPe 2.08
View in 3D
