Lineage for d1w2fa_ (1w2f A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611809Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 611810Superfamily d.143.1: SAICAR synthase-like [56104] (3 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 611825Family d.143.1.3: Inositol polyphosphate kinase (IPK) [111188] (1 protein)
    Pfam 03770
  6. 611826Protein Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A [111189] (2 species)
  7. 611827Species Human (Homo sapiens) [TaxId:9606] [111190] (3 PDB entries)
  8. 611828Domain d1w2fa_: 1w2f A: [109125]

Details for d1w2fa_

PDB Entry: 1w2f (more details), 1.8 Å

PDB Description: human inositol (1,4,5)-trisphosphate 3-kinase substituted with selenomethionine

SCOP Domain Sequences for d1w2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2fa_ d.143.1.3 (A:) Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A {Human (Homo sapiens)}
mswvqlaghtgsfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesy
lqlqdlldgfdgpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeeh
aqravtkprymqwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqg
deevlrrylnrlqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpd
gqildhrrpweegnredgyllgldnligilaslaer

SCOP Domain Coordinates for d1w2fa_:

Click to download the PDB-style file with coordinates for d1w2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1w2fa_: