Lineage for d1w2eb_ (1w2e B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2614481Fold d.244: Cell division protein ZapA-like [102828] (1 superfamily)
    core: beta(2)-alpha(2), 2 layers: alpha/beta; long C-terminal helix forms dimeric parallel and tetrameric antiparallel coiled coils
  4. 2614482Superfamily d.244.1: Cell division protein ZapA-like [102829] (2 families) (S)
    automatically mapped to Pfam PF05164
  5. 2614483Family d.244.1.1: Cell division protein ZapA-like [102830] (1 protein)
    Pfam PF05164; ZapA is a Z-ring associated protein first discovered in B. subtilis (formerly hypothetical protein YshA);
  6. 2614484Protein ZapA homologue PA5227 [102831] (1 species)
  7. 2614485Species Pseudomonas aeruginosa [TaxId:287] [102832] (2 PDB entries)
    Uniprot Q9HTW3
  8. 2614491Domain d1w2eb_: 1w2e B: [109124]

Details for d1w2eb_

PDB Entry: 1w2e (more details), 2.8 Å

PDB Description: the crystal structure of the bacterial cell division protein zapa
PDB Compounds: (B:) zapa

SCOPe Domain Sequences for d1w2eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2eb_ d.244.1.1 (B:) ZapA homologue PA5227 {Pseudomonas aeruginosa [TaxId: 287]}
tltvqildkeycincpdderanlesaaryldgkmreirssgkvigadrvavmaalnithd
llhrkerldqessstrervrelldrvdralan

SCOPe Domain Coordinates for d1w2eb_:

Click to download the PDB-style file with coordinates for d1w2eb_.
(The format of our PDB-style files is described here.)

Timeline for d1w2eb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w2ea_