SCOPe 2.08: Domain d1w2eb_: 1w2e B:

Lineage for d1w2eb_ (1w2e B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.244: Cell division protein ZapA-like [102828] (1 superfamily)
   core: beta(2)-alpha(2), 2 layers: alpha/beta; long C-terminal helix forms dimeric parallel and tetrameric antiparallel coiled coils

4. Superfamily d.244.1: Cell division protein ZapA-like [102829] (2 families)
   automatically mapped to Pfam PF05164

5. Family d.244.1.1: Cell division protein ZapA-like [102830] (1 protein)
   Pfam PF05164; ZapA is a Z-ring associated protein first discovered in B. subtilis (formerly hypothetical protein YshA);

6. Protein ZapA homologue PA5227 [102831] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [102832] (2 PDB entries)
   Uniprot Q9HTW3

8. Domain d1w2eb_: 1w2e B: [109124]

Details for d1w2eb_

PDB Entry: 1w2e, 2.8 Å

PDB Description: the crystal structure of the bacterial cell division protein zapa

PDB Compounds: (B:) zapa

SCOPe Domain Sequences for d1w2eb_:

Sequence; same for both SEQRES and ATOM records:

>d1w2eb_ d.244.1.1 (B:) ZapA homologue PA5227 {Pseudomonas aeruginosa [TaxId: 287]}
tltvqildkeycincpdderanlesaaryldgkmreirssgkvigadrvavmaalnithd
llhrkerldqessstrervrelldrvdralan

Timeline for d1w2eb_:

• d1w2eb_ first appeared in SCOP 1.69
  
• d1w2eb_ appears in SCOPe 2.07