![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.244: Cell division protein ZapA-like [102828] (1 superfamily) core: beta(2)-alpha(2), 2 layers: alpha/beta; long C-terminal helix forms dimeric parallel and tetrameric antiparallel coiled coils |
![]() | Superfamily d.244.1: Cell division protein ZapA-like [102829] (2 families) ![]() automatically mapped to Pfam PF05164 |
![]() | Family d.244.1.1: Cell division protein ZapA-like [102830] (1 protein) Pfam PF05164; ZapA is a Z-ring associated protein first discovered in B. subtilis (formerly hypothetical protein YshA); |
![]() | Protein ZapA homologue PA5227 [102831] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [102832] (2 PDB entries) Uniprot Q9HTW3 |
![]() | Domain d1w2ea_: 1w2e A: [109123] |
PDB Entry: 1w2e (more details), 2.8 Å
SCOPe Domain Sequences for d1w2ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2ea_ d.244.1.1 (A:) ZapA homologue PA5227 {Pseudomonas aeruginosa [TaxId: 287]} ntltvqildkeycincpdderanlesaaryldgkmreirssgkvigadrvavmaalnith dllhrkerldqessstrervrelldrvdrala
Timeline for d1w2ea_: