Lineage for d1w2cb_ (1w2c B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542070Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2542071Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 2542110Family d.143.1.3: Inositol polyphosphate kinase (IPK) [111188] (2 proteins)
    Pfam PF03770
  6. 2542111Protein Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A [111189] (2 species)
  7. 2542112Species Human (Homo sapiens) [TaxId:9606] [111190] (3 PDB entries)
    Uniprot P23677 187-461
  8. 2542116Domain d1w2cb_: 1w2c B: [109120]
    complexed with anp, i3p, mn, so4

Details for d1w2cb_

PDB Entry: 1w2c (more details), 1.95 Å

PDB Description: human inositol (1,4,5) trisphosphate 3-kinase complexed with mn2+/amppnp/ins(1,4,5)p3
PDB Compounds: (B:) inositol-trisphosphate 3-kinase a

SCOPe Domain Sequences for d1w2cb_:

Sequence, based on SEQRES records: (download)

>d1w2cb_ d.143.1.3 (B:) Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A {Human (Homo sapiens) [TaxId: 9606]}
sfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesylqlqdlldgfd
gpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeehaqravtkprym
qwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqgdeevlrrylnr
lqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpdgqildhrrpwe
egnredgyllgldnligilaslaer

Sequence, based on observed residues (ATOM records): (download)

>d1w2cb_ d.143.1.3 (B:) Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A {Human (Homo sapiens) [TaxId: 9606]}
sfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesylqlqdlldgfd
gpcvldckmgvrtyleeeltkklrkdmykkmlavdpavtkprymqwregisssttlgfri
egikkadgscstdfkttrsreqvlrvfeefvqgdeevlrrylnrlqqirdtlevseffrr
hevigssllfvhdhchragvwlidfgkttplpdgqildhrrpweegnredgyllgldnli
gilaslaer

SCOPe Domain Coordinates for d1w2cb_:

Click to download the PDB-style file with coordinates for d1w2cb_.
(The format of our PDB-style files is described here.)

Timeline for d1w2cb_: