Lineage for d1w2ca_ (1w2c A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217938Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2217939Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 2217978Family d.143.1.3: Inositol polyphosphate kinase (IPK) [111188] (2 proteins)
    Pfam PF03770
  6. 2217979Protein Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A [111189] (2 species)
  7. 2217980Species Human (Homo sapiens) [TaxId:9606] [111190] (3 PDB entries)
    Uniprot P23677 187-461
  8. 2217983Domain d1w2ca_: 1w2c A: [109119]
    complexed with anp, i3p, mn, so4

Details for d1w2ca_

PDB Entry: 1w2c (more details), 1.95 Å

PDB Description: human inositol (1,4,5) trisphosphate 3-kinase complexed with mn2+/amppnp/ins(1,4,5)p3
PDB Compounds: (A:) inositol-trisphosphate 3-kinase a

SCOPe Domain Sequences for d1w2ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2ca_ d.143.1.3 (A:) Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A {Human (Homo sapiens) [TaxId: 9606]}
sfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesylqlqdlldgfd
gpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeehaqravtkprym
qwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqgdeevlrrylnr
lqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpdgqildhrrpwe
egnredgyllgldnligilaslaer

SCOPe Domain Coordinates for d1w2ca_:

Click to download the PDB-style file with coordinates for d1w2ca_.
(The format of our PDB-style files is described here.)

Timeline for d1w2ca_: