Lineage for d1w2ca_ (1w2c A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511931Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 511932Superfamily d.143.1: SAICAR synthase-like [56104] (3 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 511947Family d.143.1.3: Inositol polyphosphate kinase (IPK, Pfam 03770) [111188] (1 protein)
  6. 511948Protein Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A [111189] (2 species)
  7. 511949Species Human (Homo sapiens) [TaxId:9606] [111190] (3 PDB entries)
  8. 511952Domain d1w2ca_: 1w2c A: [109119]

Details for d1w2ca_

PDB Entry: 1w2c (more details), 1.95 Å

PDB Description: human inositol (1,4,5) trisphosphate 3-kinase complexed with mn2+/amppnp/ins(1,4,5)p3

SCOP Domain Sequences for d1w2ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2ca_ d.143.1.3 (A:) Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A {Human (Homo sapiens)}
sfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesylqlqdlldgfd
gpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeehaqravtkprym
qwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqgdeevlrrylnr
lqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpdgqildhrrpwe
egnredgyllgldnligilaslaer

SCOP Domain Coordinates for d1w2ca_:

Click to download the PDB-style file with coordinates for d1w2ca_.
(The format of our PDB-style files is described here.)

Timeline for d1w2ca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w2cb_