SCOP 1.73: Domain d1w2bw_: 1w2b W:

Lineage for d1w2bw_ (1w2b W:)

1. Root: SCOP 1.73

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (3 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (2 PDB entries)

8. Domain d1w2bw_: 1w2b W: [109115]

Details for d1w2bw_

PDB Entry: 1w2b, 3.5 Å

PDB Description: trigger factor ribosome binding domain in complex with 50s

PDB Compounds: (W:) 50S ribosomal protein L31e

SCOP Domain Sequences for d1w2bw_:

Sequence; same for both SEQRES and ATOM records:

>d1w2bw_ i.1.1.2 (W:) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveaet

Timeline for d1w2bw_:

• d1w2bw_ first appeared in SCOP 1.69
  
• d1w2bw_ appears in SCOP 1.71
  
• d1w2bw_ appears in SCOP 1.75
  
• d1w2bw_ appears in the current release, SCOPe 2.08