Lineage for d1w2bp_ (1w2b P:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526851Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 526855Protein 50S subunit [58125] (3 species)
  7. 526856Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (4 PDB entries)
  8. 526875Domain d1w2bp_: 1w2b P: [109109]

Details for d1w2bp_

PDB Entry: 1w2b (more details), 3.5 Å

PDB Description: trigger factor ribosome binding domain in complex with 50s

SCOP Domain Sequences for d1w2bp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2bp_ i.1.1.2 (P:) 50S subunit {Archaeon Haloarcula marismortui}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOP Domain Coordinates for d1w2bp_:

Click to download the PDB-style file with coordinates for d1w2bp_.
(The format of our PDB-style files is described here.)

Timeline for d1w2bp_: