Lineage for d1w2bo_ (1w2b O:)

  1. Root: SCOPe 2.07
  2. 2592940Class i: Low resolution protein structures [58117] (25 folds)
  3. 2592941Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2592942Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2593959Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2594094Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2594241Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 2594511Domain d1w2bo_: 1w2b O: [109108]
    50S subunit in complex with the trigger factor
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1w2bo_

PDB Entry: 1w2b (more details), 3.5 Å

PDB Description: trigger factor ribosome binding domain in complex with 50s
PDB Compounds: (O:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d1w2bo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2bo_ i.1.1.2 (O:) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryidan

SCOPe Domain Coordinates for d1w2bo_:

Click to download the PDB-style file with coordinates for d1w2bo_.
(The format of our PDB-style files is described here.)

Timeline for d1w2bo_: