Lineage for d1w2bi_ (1w2b I:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526851Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 526855Protein 50S subunit [58125] (3 species)
  7. 526856Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (4 PDB entries)
  8. 526868Domain d1w2bi_: 1w2b I: [109102]

Details for d1w2bi_

PDB Entry: 1w2b (more details), 3.5 Å

PDB Description: trigger factor ribosome binding domain in complex with 50s

SCOP Domain Sequences for d1w2bi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2bi_ i.1.1.2 (I:) 50S subunit {Archaeon Haloarcula marismortui}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOP Domain Coordinates for d1w2bi_:

Click to download the PDB-style file with coordinates for d1w2bi_.
(The format of our PDB-style files is described here.)

Timeline for d1w2bi_: