Lineage for d1w2b5_ (1w2b 5:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1468643Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1468644Protein 50S subunit [58125] (6 species)
  7. 1468793Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 1469048Domain d1w2b5_: 1w2b 5: [109093]
    50S subunit in complex with the trigger factor
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1w2b5_

PDB Entry: 1w2b (more details), 3.5 Å

PDB Description: trigger factor ribosome binding domain in complex with 50s
PDB Compounds: (5:) Trigger Factor

SCOPe Domain Sequences for d1w2b5_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2b5_ i.1.1.2 (5:) 50S subunit {Haloarcula marismortui [TaxId: 2238]}
etavkselvnvakkvridgfrkgkvpmnivaqryg

SCOPe Domain Coordinates for d1w2b5_:

Click to download the PDB-style file with coordinates for d1w2b5_.
(The format of our PDB-style files is described here.)

Timeline for d1w2b5_: