SCOPe 2.07: Domain d1w2b1_: 1w2b 1:

Lineage for d1w2b1_ (1w2b 1:)

1. Root: SCOPe 2.07

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein Prokaryotic (50S subunit) [58125] (3 species)

7. Species Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)

8. Domain d1w2b1_: 1w2b 1: [109091]
   50S subunit in complex with the trigger factor
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1w2b1_

PDB Entry: 1w2b, 3.5 Å

PDB Description: trigger factor ribosome binding domain in complex with 50s

PDB Compounds: (1:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d1w2b1_:

Sequence, based on SEQRES records:

>d1w2b1_ i.1.1.2 (1:) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records):

>d1w2b1_ i.1.1.2 (1:) Prokaryotic (50S subunit) {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

Timeline for d1w2b1_:

• d1w2b1_ first appeared in SCOP 1.69
  
• d1w2b1_ appears in SCOPe 2.06
  
• d1w2b1_ appears in the current release, SCOPe 2.08