Lineage for d1w2b1_ (1w2b 1:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 897176Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 897177Protein 50S subunit [58125] (6 species)
  7. 897178Species Archaeon Haloarcula marismortui [TaxId:2238] [58126] (20 PDB entries)
  8. 897431Domain d1w2b1_: 1w2b 1: [109091]
    50S subunit in complex with the trigger factor

Details for d1w2b1_

PDB Entry: 1w2b (more details), 3.5 Å

PDB Description: trigger factor ribosome binding domain in complex with 50s
PDB Compounds: (1:) 50S ribosomal protein L39e

SCOP Domain Sequences for d1w2b1_:

Sequence, based on SEQRES records: (download)

>d1w2b1_ i.1.1.2 (1:) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1w2b1_ i.1.1.2 (1:) 50S subunit {Archaeon Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdernhkrrhwrrndtde

SCOP Domain Coordinates for d1w2b1_:

Click to download the PDB-style file with coordinates for d1w2b1_.
(The format of our PDB-style files is described here.)

Timeline for d1w2b1_: