![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
![]() | Protein Trigger factor PPIase domain [75388] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [89881] (3 PDB entries) Uniprot P22257 |
![]() | Domain d1w26b3: 1w26 B:132-247 [109090] Other proteins in same PDB: d1w26a1, d1w26a2, d1w26b1, d1w26b2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1w26 (more details), 2.7 Å
SCOPe Domain Sequences for d1w26b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w26b3 d.26.1.1 (B:132-247) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} vtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgq grmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpe
Timeline for d1w26b3: