![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily) multihelical; irregular array of long and short helices |
![]() | Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (2 families) ![]() there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family) |
![]() | Family a.223.1.1: TF C-terminus [109999] (1 protein) Pfam 05698; includes the upstream linker region not covered by the Pfam model |
![]() | Protein Trigger factor, C-terminal domain [110000] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [110001] (1 PDB entry) |
![]() | Domain d1w26b1: 1w26 B:248-432 [109088] Other proteins in same PDB: d1w26a2, d1w26a3, d1w26b2, d1w26b3 |
PDB Entry: 1w26 (more details), 2.7 Å
SCOP Domain Sequences for d1w26b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w26b1 a.223.1.1 (B:248-432) Trigger factor, C-terminal domain {Escherichia coli} ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel mnqqa
Timeline for d1w26b1: