Lineage for d1w26a3 (1w26 A:132-247)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601019Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 601020Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 601021Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 601157Protein Trigger factor PPIase domain [75388] (3 species)
  7. 601158Species Escherichia coli [TaxId:562] [89881] (2 PDB entries)
  8. 601159Domain d1w26a3: 1w26 A:132-247 [109087]
    Other proteins in same PDB: d1w26a1, d1w26a2, d1w26b1, d1w26b2

Details for d1w26a3

PDB Entry: 1w26 (more details), 2.7 Å

PDB Description: trigger factor in complex with the ribosome forms a molecular cradle for nascent proteins

SCOP Domain Sequences for d1w26a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w26a3 d.26.1.1 (A:132-247) Trigger factor PPIase domain {Escherichia coli}
vtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgq
grmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpe

SCOP Domain Coordinates for d1w26a3:

Click to download the PDB-style file with coordinates for d1w26a3.
(The format of our PDB-style files is described here.)

Timeline for d1w26a3: