SCOP 1.73: Domain d1w26a1: 1w26 A:248-432

Lineage for d1w26a1 (1w26 A:248-432)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
   multihelical; irregular array of long and short helices

4. Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (2 families)
   there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)

5. Family a.223.1.1: TF C-terminus [109999] (1 protein)
   Pfam PF05698; includes the upstream linker region not covered by the Pfam model

6. Protein Trigger factor, C-terminal domain [110000] (2 species)

7. Species Escherichia coli [TaxId:562] [110001] (1 PDB entry)

8. Domain d1w26a1: 1w26 A:248-432 [109085]
   Other proteins in same PDB: d1w26a2, d1w26a3, d1w26b2, d1w26b3

Details for d1w26a1

PDB Entry: 1w26, 2.7 Å

PDB Description: trigger factor in complex with the ribosome forms a molecular cradle for nascent proteins

PDB Compounds: (A:) Trigger Factor

SCOP Domain Sequences for d1w26a1:

Sequence; same for both SEQRES and ATOM records:

>d1w26a1 a.223.1.1 (A:248-432) Trigger factor, C-terminal domain {Escherichia coli [TaxId: 562]}
ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali
dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv
kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel
mnqqa

Timeline for d1w26a1:

• d1w26a1 first appeared in SCOP 1.69
  
• d1w26a1 appears in SCOP 1.71
  
• d1w26a1 appears in SCOP 1.75
  
• d1w26a1 appears in the current release, SCOPe 2.08