Lineage for d1w22b_ (1w22 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115600Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 protein domains)
    automatically mapped to Pfam PF00850
  6. 2115633Protein Histone deacetylase 8, HDAC8 [110587] (1 species)
  7. 2115634Species Human (Homo sapiens) [TaxId:9606] [110588] (5 PDB entries)
    Uniprot Q9BY41 13-375 ! Uniprot Q9BY41
  8. 2115641Domain d1w22b_: 1w22 B: [109084]
    complexed with k, nhb, zn

Details for d1w22b_

PDB Entry: 1w22 (more details), 2.5 Å

PDB Description: Crystal structure of inhibited human HDAC8
PDB Compounds: (B:) Histone deacetylase 8

SCOPe Domain Sequences for d1w22b_:

Sequence, based on SEQRES records: (download)

>d1w22b_ c.42.1.2 (B:) Histone deacetylase 8, HDAC8 {Human (Homo sapiens) [TaxId: 9606]}
vpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtda
ylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckva
inwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftsk
vmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqa
fnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantarc
wtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlk
h

Sequence, based on observed residues (ATOM records): (download)

>d1w22b_ c.42.1.2 (B:) Histone deacetylase 8, HDAC8 {Human (Homo sapiens) [TaxId: 9606]}
vpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtda
ylqhlqkvsqeyglgydcpategifdyaaaiggatitaaqclidgmckvainwsggwhha
kkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsftskvmtvslhkfs
pgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyqafnpkavvlql
gadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantarcwtyltgvilg
ktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnlkh

SCOPe Domain Coordinates for d1w22b_:

Click to download the PDB-style file with coordinates for d1w22b_.
(The format of our PDB-style files is described here.)

Timeline for d1w22b_: