Lineage for d1w1ua_ (1w1u A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2626033Fold e.51: Urocanase [111325] (1 superfamily)
    3 domains; d1: alpha+beta [alpha(2)-beta(3); mixed sheet: 213]; d2: alpha/beta of the NAD(P)-binding Rossmann-fold superfamily (51735); d3: alpha+beta of the glutamine synthetase/guanido kinase fold (55930); d1 and d3 form a single beta-sheet
  4. 2626034Superfamily e.51.1: Urocanase [111326] (2 families) (S)
    automatically mapped to Pfam PF01175
  5. 2626035Family e.51.1.1: Urocanase [111327] (2 proteins)
    Pfam PF01175
  6. 2626036Protein Urocanate hydratase HutU [111328] (2 species)
  7. 2626040Species Pseudomonas putida [TaxId:303] [111329] (3 PDB entries)
    Uniprot P25080; d1:4-138; d2:135-350; d3: 351-557
  8. 2626045Domain d1w1ua_: 1w1u A: [109079]
    complexed with nad, uro

Details for d1w1ua_

PDB Entry: 1w1u (more details), 2.23 Å

PDB Description: inactive urocanase-sa cocrystallized with urocanate
PDB Compounds: (A:) Urocanate hydratase

SCOPe Domain Sequences for d1w1ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1ua_ e.51.1.1 (A:) Urocanate hydratase HutU {Pseudomonas putida [TaxId: 303]}
nnyrdveiraprgnkltakswlteaplrmlmnnldpqvaenpkelvvyggigraarnwec
ydkivetltrleddetllvqsgkpvgvfkthsnaprvliansnlvphwanwehfneldak
glamygqmtagswiyigsqgivqgtyetfveagrqhyggslkgkwvltaglggmggaqpl
aatlagacslniesqqsridfrletryvdeqatdlddalvriakytaegkaisialhgna
aeilpelvkrgvrpdmvtdqtsahdplngylpagwtweqyrdraqtepaavvkaakqsma
vhvqamldfqkqgvptfdygnnirqmakeegvanafdfpgfvpayirplfcrgvgpfrwa
alsgeaediyktdakvkelipddahlhrwldmarerisfqglparicwvglglraklgla
fnemvrsgelsapvvigrdhldsgsvsspnaeteamrdgsdavsdwpllnallntaggat
wvslhhgggvgmgfsqhsgmvivcdgtdeaaeriarvltndpgtgvmrhadagydiaidc
akeqgldlpmi

SCOPe Domain Coordinates for d1w1ua_:

Click to download the PDB-style file with coordinates for d1w1ua_.
(The format of our PDB-style files is described here.)

Timeline for d1w1ua_: