Lineage for d1w1sa2 (1w1s A:40-245)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2547890Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2547891Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2547892Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)
  6. 2547912Protein Cytokinin dehydrogenase 1 [111207] (1 species)
  7. 2547913Species Maize (Zea mays) [TaxId:4577] [111208] (4 PDB entries)
    Uniprot Q9T0N8
  8. 2547917Domain d1w1sa2: 1w1s A:40-245 [109078]
    Other proteins in same PDB: d1w1sa1
    complexed with emu, fad, nag

Details for d1w1sa2

PDB Entry: 1w1s (more details), 2 Å

PDB Description: plant cytokinin dehydrogenase in complex with benzylaminopurine
PDB Compounds: (A:) cytokinin dehydrogenase

SCOPe Domain Sequences for d1w1sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1sa2 d.145.1.1 (A:40-245) Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 4577]}
alaldgklrtdsnataaastdfgnitsalpaavlypsstgdlvallsaanstpgwpytia
frgrghslmgqafapggvvvnmaslgdaaapprinvsadgryvdaggeqvwidvlrasla
rgvaprswtdylyltvggtlsnagisgqafrhgpqisnvlemdvitghgemvtcskqlna
dlfdavlgglgqfgvitrariavepa

SCOPe Domain Coordinates for d1w1sa2:

Click to download the PDB-style file with coordinates for d1w1sa2.
(The format of our PDB-style files is described here.)

Timeline for d1w1sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w1sa1