Lineage for d1w1sa1 (1w1s A:246-534)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725809Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (4 families) (S)
    duplication: contains two subdomains of this fold
  5. 725864Family d.58.32.4: Cytokinin dehydrogenase 1 [110990] (1 protein)
  6. 725865Protein Cytokinin dehydrogenase 1 [110991] (1 species)
  7. 725866Species Maize (Zea mays) [TaxId:4577] [110992] (4 PDB entries)
  8. 725870Domain d1w1sa1: 1w1s A:246-534 [109077]
    Other proteins in same PDB: d1w1sa2
    complexed with emu, fad, nag

Details for d1w1sa1

PDB Entry: 1w1s (more details), 2 Å

PDB Description: plant cytokinin dehydrogenase in complex with benzylaminopurine
PDB Compounds: (A:) cytokinin dehydrogenase

SCOP Domain Sequences for d1w1sa1:

Sequence, based on SEQRES records: (download)

>d1w1sa1 d.58.32.4 (A:246-534) Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 4577]}
pararwvrfvytdfaafsadqerltaprpggggasfgpmsyvegsvfvnqslatdlantg
fftdadvarivalagernattvysieatlnydnataaaaavdqelasvlgtlsyvegfaf
qrdvayaafldrvhgeevalnklglwrvphpwlnmfvprsriadfdrgvfkgilqgtdiv
gplivyplnksmwddgmsaatpsedvfyavsllfssvapndlarlqeqnrrilrfcdlag
iqyktylarhtdrsdwvrhfgaakwnrfvemknkydpkrllspgqdifn

Sequence, based on observed residues (ATOM records): (download)

>d1w1sa1 d.58.32.4 (A:246-534) Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 4577]}
pararwvrfvytdfaafsadqerltaprsfgpmsyvegsvfvnqslatdlantgfftdad
varivalagernattvysieatlnyaavdqelasvlgtlsyvegfafqrdvayaafldrv
hgeevalnklglwrvphpwlnmfvprsriadfdrgvfkgilqgtdivgplivyplnksmw
ddgmsaatpsedvfyavsllfssndlarlqeqnrrilrfcdlagiqyktylarhtdrsdw
vrhfgaakwnrfvemknkydpkrllspgqdifn

SCOP Domain Coordinates for d1w1sa1:

Click to download the PDB-style file with coordinates for d1w1sa1.
(The format of our PDB-style files is described here.)

Timeline for d1w1sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w1sa2