Lineage for d1w1qa1 (1w1q A:246-534)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2521989Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2522054Family d.58.32.4: Cytokinin dehydrogenase 1 [110990] (2 proteins)
    automatically mapped to Pfam PF09265
  6. 2522055Protein Cytokinin dehydrogenase 1 [110991] (1 species)
  7. 2522056Species Maize (Zea mays) [TaxId:4577] [110992] (4 PDB entries)
    Uniprot Q9T0N8
  8. 2522058Domain d1w1qa1: 1w1q A:246-534 [109073]
    Other proteins in same PDB: d1w1qa2
    complexed with fad, nag, zip

Details for d1w1qa1

PDB Entry: 1w1q (more details), 1.8 Å

PDB Description: plant cytokinin dehydrogenase in complex with isopentenyladenine
PDB Compounds: (A:) cytokinin dehydrogenase 1

SCOPe Domain Sequences for d1w1qa1:

Sequence, based on SEQRES records: (download)

>d1w1qa1 d.58.32.4 (A:246-534) Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 4577]}
pararwvrfvytdfaafsadqerltaprpggggasfgpmsyvegsvfvnqslatdlantg
fftdadvarivalagernattvysieatlnydnataaaaavdqelasvlgtlsyvegfaf
qrdvayaafldrvhgeevalnklglwrvphpwlnmfvprsriadfdrgvfkgilqgtdiv
gplivyplnksmwddgmsaatpsedvfyavsllfssvapndlarlqeqnrrilrfcdlag
iqyktylarhtdrsdwvrhfgaakwnrfvemknkydpkrllspgqdifn

Sequence, based on observed residues (ATOM records): (download)

>d1w1qa1 d.58.32.4 (A:246-534) Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 4577]}
pararwvrfvytdfaafsadqerltaprsfgpmsyvegsvfvnqslatdlantgfftdad
varivalagernattvysieatlnyaavdqelasvlgtlsyvegfafqrdvayaafldrv
hgeevalnklglwrvphpwlnmfvprsriadfdrgvfkgilqgtdivgplivyplnksmw
ddgmsaatpsedvfyavsllfssndlarlqeqnrrilrfcdlagiqyktylarhtdrsdw
vrhfgaakwnrfvemknkydpkrllspgqdifn

SCOPe Domain Coordinates for d1w1qa1:

Click to download the PDB-style file with coordinates for d1w1qa1.
(The format of our PDB-style files is described here.)

Timeline for d1w1qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w1qa2