Lineage for d1w1oa2 (1w1o A:40-245)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
consists of two alpha+beta subdomainsSuperfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) 
Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins) 
Protein Cytokinin dehydrogenase 1 [111207] (1 species) Species Maize (Zea mays) [TaxId:4577] [111208] (4 PDB entries)
Uniprot Q9T0N8
Domain d1w1oa2: 1w1o A:40-245 [109072]
Other proteins in same PDB: d1w1oa1
complexed with fad, nag
Details for d1w1oa2
PDB Entry: 1w1o (more details), 1.7 Å
PDB Description: native cytokinin dehydrogenase
PDB Compounds: (A:) cytokinin dehydrogenase 1SCOPe Domain Sequences for d1w1oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w1oa2 d.145.1.1 (A:40-245) Cytokinin dehydrogenase 1 {Maize (Zea mays) [TaxId: 4577]}
alaldgklrtdsnataaastdfgnitsalpaavlypsstgdlvallsaanstpgwpytia
frgrghslmgqafapggvvvnmaslgdaaapprinvsadgryvdaggeqvwidvlrasla
rgvaprswtdylyltvggtlsnagisgqafrhgpqisnvlemdvitghgemvtcskqlna
dlfdavlgglgqfgvitrariavepa
SCOPe Domain Coordinates for d1w1oa2:
Click to download the PDB-style file with coordinates for d1w1oa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1w1oa2:
- d1w1oa2 first appeared in SCOP 1.69
- d1w1oa2 appears in SCOPe 2.07
View in 3D
