Lineage for d1w1ka2 (1w1k A:6-273)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2547890Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2547891Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2547892Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)
  6. 2547928Protein Vanillyl-alcohol oxidase [56178] (1 species)
  7. 2547929Species Fungus (Penicillium simplicissimum) [TaxId:69488] [56179] (16 PDB entries)
    Uniprot P56216
  8. 2547938Domain d1w1ka2: 1w1k A:6-273 [109060]
    Other proteins in same PDB: d1w1ka1, d1w1kb1
    complexed with eug, fad; mutant

Details for d1w1ka2

PDB Entry: 1w1k (more details), 2.55 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase: ile238thr mutant
PDB Compounds: (A:) vanillyl-alcohol oxidase

SCOPe Domain Sequences for d1w1ka2:

Sequence, based on SEQRES records: (download)

>d1w1ka2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwsktahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

Sequence, based on observed residues (ATOM records): (download)

>d1w1ka2 d.145.1.1 (A:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum) [TaxId: 69488]}
efrpltlppklslsdfnefiqdiirivgsenvevisvdgsymkpththdphhvmdqdyfl
asaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrv
levnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpy
gdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwsktahlfpygfgpyi
dglfsqsnmgivtkigiwlmpnp

SCOPe Domain Coordinates for d1w1ka2:

Click to download the PDB-style file with coordinates for d1w1ka2.
(The format of our PDB-style files is described here.)

Timeline for d1w1ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w1ka1