Lineage for d1w1jb2 (1w1j B:6-273)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512542Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 512543Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 512544Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (5 proteins)
  6. 512565Protein Vanillyl-alcohol oxidase [56178] (1 species)
  7. 512566Species Fungus (Penicillium simplicissimum) [TaxId:69488] [56179] (16 PDB entries)
  8. 512586Domain d1w1jb2: 1w1j B:6-273 [109058]
    Other proteins in same PDB: d1w1ja1, d1w1jb1

Details for d1w1jb2

PDB Entry: 1w1j (more details), 2.7 Å

PDB Description: structure of the octameric flavoenzyme vanillyl-alcohol oxidase: the505ser mutant

SCOP Domain Sequences for d1w1jb2:

Sequence, based on SEQRES records: (download)

>d1w1jb2 d.145.1.1 (B:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
efrpltlppklslsdfnefiqdiirivgsenvevisskdqivdgsymkpththdphhvmd
qdyflasaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgk
nmnrvlevnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergv
gytpygdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpyg
fgpyidglfsqsnmgivtkigiwlmpnp

Sequence, based on observed residues (ATOM records): (download)

>d1w1jb2 d.145.1.1 (B:6-273) Vanillyl-alcohol oxidase {Fungus (Penicillium simplicissimum)}
efrpltlppklslsdfnefiqdiirivgsenvevisvdgsymkpththdphhvmdqdyfl
asaivaprnvadvqsivglankfsfplwpisigrnsgyggaaprvsgsvvldmgknmnrv
levnvegaycvvepgvtyhdlhnyleannlrdklwldvpdlgggsvlgnavergvgytpy
gdhwmmhsgmevvlangellrtgmgalpdpkrpetmglkpedqpwskiahlfpygfgpyi
dglfsqsnmgivtkigiwlmpnp

SCOP Domain Coordinates for d1w1jb2:

Click to download the PDB-style file with coordinates for d1w1jb2.
(The format of our PDB-style files is described here.)

Timeline for d1w1jb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w1jb1