![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins) |
![]() | Protein Adenosine deaminase (ADA) [51558] (4 species) Common fold covers the whole protein structure |
![]() | Species Cow (Bos taurus) [TaxId:9913] [82257] (13 PDB entries) Uniprot P56658 3-350 ! Uniprot P56658 |
![]() | Domain d1w1ih_: 1w1i H: [109054] Other proteins in same PDB: d1w1ia1, d1w1ia2, d1w1ib1, d1w1ib2, d1w1ic1, d1w1ic2, d1w1id1, d1w1id2 complexed with nag, zn |
PDB Entry: 1w1i (more details), 3.03 Å
SCOPe Domain Sequences for d1w1ih_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w1ih_ c.1.9.1 (H:) Adenosine deaminase (ADA) {Cow (Bos taurus) [TaxId: 9913]} tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpdfla kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmps
Timeline for d1w1ih_: