Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.1: Adenosine deaminase (ADA) [51557] (1 protein) |
Protein Adenosine deaminase (ADA) [51558] (2 species) Common fold covers the whole protein structure |
Species Cow (Bos taurus) [TaxId:9913] [82257] (9 PDB entries) |
Domain d1w1ig_: 1w1i G: [109053] Other proteins in same PDB: d1w1ia1, d1w1ia2, d1w1ib1, d1w1ib2, d1w1ic1, d1w1ic2, d1w1id1, d1w1id2 |
PDB Entry: 1w1i (more details), 3.03 Å
SCOP Domain Sequences for d1w1ig_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w1ig_ c.1.9.1 (G:) Adenosine deaminase (ADA) {Cow (Bos taurus)} tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpdfla kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmps
Timeline for d1w1ig_: