Lineage for d1w1if_ (1w1i F:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475145Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 475146Family c.1.9.1: Adenosine deaminase (ADA) [51557] (1 protein)
  6. 475147Protein Adenosine deaminase (ADA) [51558] (2 species)
    Common fold covers the whole protein structure
  7. 475148Species Cow (Bos taurus) [TaxId:9913] [82257] (9 PDB entries)
  8. 475158Domain d1w1if_: 1w1i F: [109052]
    Other proteins in same PDB: d1w1ia1, d1w1ia2, d1w1ib1, d1w1ib2, d1w1ic1, d1w1ic2, d1w1id1, d1w1id2

Details for d1w1if_

PDB Entry: 1w1i (more details), 3.03 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dppiv or cd26) in complex with adenosine deaminase

SCOP Domain Sequences for d1w1if_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1if_ c.1.9.1 (F:) Adenosine deaminase (ADA) {Cow (Bos taurus)}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmps

SCOP Domain Coordinates for d1w1if_:

Click to download the PDB-style file with coordinates for d1w1if_.
(The format of our PDB-style files is described here.)

Timeline for d1w1if_: