SCOP 1.69: Domain d1w1ib1: 1w1i B:39-508

Lineage for d1w1ib1 (1w1i B:39-508)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: Dipeptidyl peptidase IV/CD26, N-terminal domain [82171] (1 family)

5. Family b.70.3.1: Dipeptidyl peptidase IV/CD26, N-terminal domain [82172] (1 protein)

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82174] (10 PDB entries)

8. Domain d1w1ib1: 1w1i B:39-508 [109045]
   Other proteins in same PDB: d1w1ia2, d1w1ib2, d1w1ic2, d1w1id2, d1w1ie_, d1w1if_, d1w1ig_, d1w1ih_

Details for d1w1ib1

PDB Entry: 1w1i, 3.03 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dppiv or cd26) in complex with adenosine deaminase

SCOP Domain Sequences for d1w1ib1:

Sequence; same for both SEQRES and ATOM records:

>d1w1ib1 b.70.3.1 (B:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens)}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d1w1ib1:

• d1w1ib1 is new in SCOP 1.69
  
• d1w1ib1 appears in SCOP 1.71
  
• d1w1ib1 appears in the current release, SCOPe 2.08