Lineage for d1w1ia1 (1w1i A:39-508)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419317Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2419478Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2419479Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 2419486Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 2419487Species Human (Homo sapiens) [TaxId:9606] [82174] (98 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2419644Domain d1w1ia1: 1w1i A:39-508 [109043]
    Other proteins in same PDB: d1w1ia2, d1w1ib2, d1w1ic2, d1w1id2, d1w1ie_, d1w1if_, d1w1ig_, d1w1ih_
    complexed with nag, ndg, zn

Details for d1w1ia1

PDB Entry: 1w1i (more details), 3.03 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dppiv or cd26) in complex with adenosine deaminase
PDB Compounds: (A:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1w1ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1ia1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d1w1ia1:

Click to download the PDB-style file with coordinates for d1w1ia1.
(The format of our PDB-style files is described here.)

Timeline for d1w1ia1: