![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.7: C2 domain-like [49561] (4 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein Synaptotagmin IV [101562] (2 species) duplication: contains 2 C2 domains |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [110115] (2 PDB entries) |
![]() | Domain d1w15a_: 1w15 A: [109041] second C2 domain complexed with ca, cl, na |
PDB Entry: 1w15 (more details), 1.93 Å
SCOP Domain Sequences for d1w15a_:
Sequence, based on SEQRES records: (download)
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} rgellvslcyqsttntltvvvlkarhlpksdvsglsdpyvkvnlyhakkriskkkthvkk ctpnavfnelfvfdipcesleeisveflvldsergsrnevigrlvlgataegsggghwke icdfprrqiakwhmlcdg
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} rgellvslcyqsttntltvvvlkarhlplsdpyvkvnlyhakkriskkkthvkkctpnav fnelfvfdipcesleeisveflvldsergsrnevigrlvlgataegsggghwkeicdfpr rqiakwhmlcdg
Timeline for d1w15a_: