Lineage for d1w0pa3 (1w0p A:217-346,A:544-777)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2417089Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2417090Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2417422Protein Vibrio cholerae sialidase [50950] (2 species)
    contains 2 additional domains of ConA-like fold
  7. 2417426Species Vibrio cholerae [TaxId:666] [50951] (3 PDB entries)
    Uniprot P37060
  8. 2417427Domain d1w0pa3: 1w0p A:217-346,A:544-777 [109040]
    Other proteins in same PDB: d1w0pa1, d1w0pa2
    complexed with ca, gol, sia, trs

Details for d1w0pa3

PDB Entry: 1w0p (more details), 1.6 Å

PDB Description: vibrio cholerae sialidase with alpha-2,6-sialyllactose
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1w0pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0pa3 b.68.1.1 (A:217-346,A:544-777) Vibrio cholerae sialidase {Vibrio cholerae [TaxId: 666]}
vifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrtsrdggitwdtel
nlteqinvsdefdfsdprpiydpssntvlvsyarwptdaaqngdrikpwmpngifysvyd
vasgnwqapiXvnpgpghgitltrqqnisgsqngrliypaivldrfflnvmsiysddggs
nwqtgstlpipfrwksssiletlepseadmvelqngdllltarldfnqivngvnysprqq
flskdggitwslleannanvfsnistgtvdasitrfeqsdgshfllftnpqgnpagtngr
qnlglwfsfdegvtwkgpiqlvngasaysdiyqldsenaivivetdnsnmrilrmpitll
kqklt

SCOPe Domain Coordinates for d1w0pa3:

Click to download the PDB-style file with coordinates for d1w0pa3.
(The format of our PDB-style files is described here.)

Timeline for d1w0pa3: