![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein) |
![]() | Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (2 species) both domains have this fold rest of protein is beta-propeller of six sheets |
![]() | Species Vibrio cholerae [TaxId:666] [49967] (3 PDB entries) Uniprot P37060 |
![]() | Domain d1w0pa2: 1w0p A:347-543 [109039] Other proteins in same PDB: d1w0pa3 complexed with ca, gol, sia, trs |
PDB Entry: 1w0p (more details), 1.6 Å
SCOPe Domain Sequences for d1w0pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0pa2 b.29.1.8 (A:347-543) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae [TaxId: 666]} dvtdqvkersfqiagwggselyrrntslnsqqdwqsnakirivdgaanqiqvadgsrkyv vtlsidesgglvanlngvsapiilqsehakvhsfhdyelqysalnhtttlfvdgqqittw agevsqenniqfgnadaqidgrlhvqkivltqqghnlvefdafylaqqtpevekdleklg wtkiktgntmslygnas
Timeline for d1w0pa2: