SCOPe 2.06: Domain d1w0pa1: 1w0p A:25-216

Lineage for d1w0pa1 (1w0p A:25-216)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein)

6. Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (2 species)
   both domains have this fold
   rest of protein is beta-propeller of six sheets

7. Species Vibrio cholerae [TaxId:666] [49967] (3 PDB entries)
   Uniprot P37060

8. Domain d1w0pa1: 1w0p A:25-216 [109038]
   Other proteins in same PDB: d1w0pa3
   complexed with ca, gol, sia, trs

Details for d1w0pa1

PDB Entry: 1w0p, 1.6 Å

PDB Description: vibrio cholerae sialidase with alpha-2,6-sialyllactose

PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1w0pa1:

Sequence; same for both SEQRES and ATOM records:

>d1w0pa1 b.29.1.8 (A:25-216) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae [TaxId: 666]}
alfdynatgdtefdspakqgwmqdntnngsgvltnadgmpawlvqgiggraqwtyslstn
qhaqassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvl
atgtaateyhkfelvflpgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgva
ayrdikfeiqgd

Timeline for d1w0pa1:

• d1w0pa1 first appeared in SCOP 1.69
  
• d1w0pa1 appears in SCOPe 2.05
  
• d1w0pa1 appears in SCOPe 2.07
  
• d1w0pa1 appears in the current release, SCOPe 2.08