Lineage for d1w0pa1 (1w0p A:25-216)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779906Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein)
  6. 2779907Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (2 species)
    both domains have this fold
    rest of protein is beta-propeller of six sheets
  7. 2779913Species Vibrio cholerae [TaxId:666] [49967] (3 PDB entries)
    Uniprot P37060
  8. 2779914Domain d1w0pa1: 1w0p A:25-216 [109038]
    Other proteins in same PDB: d1w0pa3
    complexed with ca, gol, sia, trs

Details for d1w0pa1

PDB Entry: 1w0p (more details), 1.6 Å

PDB Description: vibrio cholerae sialidase with alpha-2,6-sialyllactose
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1w0pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0pa1 b.29.1.8 (A:25-216) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae [TaxId: 666]}
alfdynatgdtefdspakqgwmqdntnngsgvltnadgmpawlvqgiggraqwtyslstn
qhaqassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvl
atgtaateyhkfelvflpgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgva
ayrdikfeiqgd

SCOPe Domain Coordinates for d1w0pa1:

Click to download the PDB-style file with coordinates for d1w0pa1.
(The format of our PDB-style files is described here.)

Timeline for d1w0pa1: