Class b: All beta proteins [48724] (144 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (10 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) |
Family b.68.1.1: Sialidases (neuraminidases) [50940] (8 proteins) |
Protein Vibrio cholerae sialidase [50950] (1 species) contains 2 additional domains of ConA-like fold |
Species Vibrio cholerae [TaxId:666] [50951] (3 PDB entries) |
Domain d1w0oa3: 1w0o A:217-346,A:544-777 [109037] Other proteins in same PDB: d1w0oa1, d1w0oa2 |
PDB Entry: 1w0o (more details), 1.9 Å
SCOP Domain Sequences for d1w0oa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0oa3 b.68.1.1 (A:217-346,A:544-777) Vibrio cholerae sialidase {Vibrio cholerae} vifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrtsrdggitwdtel nlteqinvsdefdfsdprpiydpssntvlvsyarwptdaaqngdrikpwmpngifysvyd vasgnwqapiXvnpgpghgitltrqqnisgsqngrliypaivldrfflnvmsiysddggs nwqtgstlpipfrwksssiletlepseadmvelqngdllltarldfnqivngvnysprqq flskdggitwslleannanvfsnistgtvdasitrfeqsdgshfllftnpqgnpagtngr qnlglwfsfdegvtwkgpiqlvngasaysdiyqldsenaivivetdnsnmrilrmpitll kqklt
Timeline for d1w0oa3: