Lineage for d1w0oa3 (1w0o A:217-346,A:544-777)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065261Protein Vibrio cholerae sialidase [50950] (2 species)
    contains 2 additional domains of ConA-like fold
  7. 2065262Species Vibrio cholerae [TaxId:666] [50951] (3 PDB entries)
    Uniprot P37060
  8. 2065264Domain d1w0oa3: 1w0o A:217-346,A:544-777 [109037]
    Other proteins in same PDB: d1w0oa1, d1w0oa2
    complexed with ca, dan, sia

Details for d1w0oa3

PDB Entry: 1w0o (more details), 1.9 Å

PDB Description: vibrio cholerae sialidase
PDB Compounds: (A:) sialidase

SCOPe Domain Sequences for d1w0oa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0oa3 b.68.1.1 (A:217-346,A:544-777) Vibrio cholerae sialidase {Vibrio cholerae [TaxId: 666]}
vifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrtsrdggitwdtel
nlteqinvsdefdfsdprpiydpssntvlvsyarwptdaaqngdrikpwmpngifysvyd
vasgnwqapiXvnpgpghgitltrqqnisgsqngrliypaivldrfflnvmsiysddggs
nwqtgstlpipfrwksssiletlepseadmvelqngdllltarldfnqivngvnysprqq
flskdggitwslleannanvfsnistgtvdasitrfeqsdgshfllftnpqgnpagtngr
qnlglwfsfdegvtwkgpiqlvngasaysdiyqldsenaivivetdnsnmrilrmpitll
kqklt

SCOPe Domain Coordinates for d1w0oa3:

Click to download the PDB-style file with coordinates for d1w0oa3.
(The format of our PDB-style files is described here.)

Timeline for d1w0oa3: