| Class b: All beta proteins [48724] (178 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
| Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein) |
| Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (2 species) both domains have this fold rest of protein is beta-propeller of six sheets |
| Species Vibrio cholerae [TaxId:666] [49967] (3 PDB entries) Uniprot P37060 |
| Domain d1w0oa2: 1w0o A:347-543 [109036] Other proteins in same PDB: d1w0oa3 complexed with ca, dan, sia |
PDB Entry: 1w0o (more details), 1.9 Å
SCOPe Domain Sequences for d1w0oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w0oa2 b.29.1.8 (A:347-543) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae [TaxId: 666]}
dvtdqvkersfqiagwggselyrrntslnsqqdwqsnakirivdgaanqiqvadgsrkyv
vtlsidesgglvanlngvsapiilqsehakvhsfhdyelqysalnhtttlfvdgqqittw
agevsqenniqfgnadaqidgrlhvqkivltqqghnlvefdafylaqqtpevekdleklg
wtkiktgntmslygnas
Timeline for d1w0oa2: