Lineage for d1w0oa1 (1w0o A:25-216)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460470Family b.29.1.8: Vibrio cholerae sialidase, N-terminal and insertion domains [49965] (1 protein)
  6. 460471Protein Vibrio cholerae sialidase, N-terminal and insertion domains [49966] (1 species)
    both domains have this fold
    rest of protein is beta-propeller of six sheets
  7. 460472Species Vibrio cholerae [TaxId:666] [49967] (3 PDB entries)
  8. 460475Domain d1w0oa1: 1w0o A:25-216 [109035]
    Other proteins in same PDB: d1w0oa3

Details for d1w0oa1

PDB Entry: 1w0o (more details), 1.9 Å

PDB Description: vibrio cholerae sialidase

SCOP Domain Sequences for d1w0oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0oa1 b.29.1.8 (A:25-216) Vibrio cholerae sialidase, N-terminal and insertion domains {Vibrio cholerae}
alfdynatgdtefdspakqgwmqdntnngsgvltnadgmpawlvqgiggraqwtyslstn
qhaqassfgwrmttemkvlsggmitnyyangtqrvlpiisldssgnlvvefegqtgrtvl
atgtaateyhkfelvflpgsnpsasfyfdgklirdniqptaskqnmivwgngssntdgva
ayrdikfeiqgd

SCOP Domain Coordinates for d1w0oa1:

Click to download the PDB-style file with coordinates for d1w0oa1.
(The format of our PDB-style files is described here.)

Timeline for d1w0oa1: