Lineage for d1w0mf_ (1w0m F:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143365Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1143366Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
  6. 1143367Protein Triosephosphate isomerase [51353] (21 species)
  7. 1143534Species Thermoproteus tenax [TaxId:2271] [110342] (1 PDB entry)
    Uniprot Q8NKN9
  8. 1143540Domain d1w0mf_: 1w0m F: [109032]
    complexed with po4

Details for d1w0mf_

PDB Entry: 1w0m (more details), 2.5 Å

PDB Description: triosephosphate isomerase from thermoproteus tenax
PDB Compounds: (F:) triosephosphate isomerase

SCOPe Domain Sequences for d1w0mf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0mf_ c.1.1.1 (F:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]}
mrlpiliinfkaygeaagkravelakaaeraarelgvnivvapnhlelglvsqsvdipvy
aqgadveaggahtahvslenikeaggsgvilnhseaplklndlarlvakakslgldvvvc
apdprtslaaaalgphavaveppeligtgravsrykpeaivetvglvsrhfpevsvitga
giesgddvaaalrlgtrgvllasaavkakdpyakivelakplsel

SCOPe Domain Coordinates for d1w0mf_:

Click to download the PDB-style file with coordinates for d1w0mf_.
(The format of our PDB-style files is described here.)

Timeline for d1w0mf_: