Lineage for d1w0md_ (1w0m D:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814175Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (1 family) (S)
  5. 814176Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (1 protein)
  6. 814177Protein Triosephosphate isomerase [51353] (18 species)
  7. 814303Species Thermoproteus tenax [TaxId:2271] [110342] (1 PDB entry)
    Uniprot Q8NKN9
  8. 814307Domain d1w0md_: 1w0m D: [109030]

Details for d1w0md_

PDB Entry: 1w0m (more details), 2.5 Å

PDB Description: triosephosphate isomerase from thermoproteus tenax
PDB Compounds: (D:) triosephosphate isomerase

SCOP Domain Sequences for d1w0md_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0md_ c.1.1.1 (D:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]}
mrlpiliinfkaygeaagkravelakaaeraarelgvnivvapnhlelglvsqsvdipvy
aqgadveaggahtahvslenikeaggsgvilnhseaplklndlarlvakakslgldvvvc
apdprtslaaaalgphavaveppeligtgravsrykpeaivetvglvsrhfpevsvitga
giesgddvaaalrlgtrgvllasaavkakdpyakivelakplselr

SCOP Domain Coordinates for d1w0md_:

Click to download the PDB-style file with coordinates for d1w0md_.
(The format of our PDB-style files is described here.)

Timeline for d1w0md_: