Lineage for d1w0ke2 (1w0k E:9-81)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2408137Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2408138Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2408139Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2408210Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species)
  7. 2408259Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries)
    Uniprot P00829
  8. 2408294Domain d1w0ke2: 1w0k E:9-81 [109021]
    Other proteins in same PDB: d1w0ka1, d1w0ka2, d1w0ka3, d1w0kb1, d1w0kb2, d1w0kb3, d1w0kc1, d1w0kc2, d1w0kc3, d1w0kd1, d1w0kd3, d1w0ke1, d1w0ke3, d1w0kf1, d1w0kf3, d1w0kg_
    complexed with adp, gol, mg, po4

Details for d1w0ke2

PDB Entry: 1w0k (more details), 2.85 Å

PDB Description: ADP inhibited bovine F1-ATPase
PDB Compounds: (E:) ATP synthase beta chain, mitochondrial precursor

SCOPe Domain Sequences for d1w0ke2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0ke2 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOPe Domain Coordinates for d1w0ke2:

Click to download the PDB-style file with coordinates for d1w0ke2.
(The format of our PDB-style files is described here.)

Timeline for d1w0ke2: